Problem: In this exercise, you will compare the amino acid sequence from the aphid to the amino acid sequences of the other species to identify how similar they are. As a first step, you will compare the aphid sequence (Acyrthosiphon) to a bacterial sequence (Pantoea).The sequences below show the first 60 amino acids of one polypeptide, using the one-letter abbreviations for the amino acids. An underscore (_) indicates a gap inserted in a sequence to optimize its alignment with the corresponding sequence in Arabidopsis.Acyrthosiphon (aphid)IKIIIIGSGVGGTAAAARLSKKGFQVEVYEKNSYNGGRCSIIR_HNGHRFDQGPSL__YLPantoea (bacterium)KRTFVIGAGFGGLALAIRLQAAGIATTVLEQHDKPGGRAYVWQ_DQGFTFDAGPTV__ITAt how many positions are the amino acids the same between the two species?

FREE Expert Solution

Comparing the Sequences:

View Complete Written Solution
Problem Details

In this exercise, you will compare the amino acid sequence from the aphid to the amino acid sequences of the other species to identify how similar they are. As a first step, you will compare the aphid sequence (Acyrthosiphon) to a bacterial sequence (Pantoea).

The sequences below show the first 60 amino acids of one polypeptide, using the one-letter abbreviations for the amino acids. An underscore (_) indicates a gap inserted in a sequence to optimize its alignment with the corresponding sequence in Arabidopsis.


At how many positions are the amino acids the same between the two species?

Frequently Asked Questions

What scientific concept do you need to know in order to solve this problem?

Our tutors have indicated that to solve this problem you will need to apply the Studying Proteins concept. You can view video lessons to learn Studying Proteins. Or if you need more Studying Proteins practice, you can also practice Studying Proteins practice problems.